SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb020286 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb020286
Domain Number 1 Region: 51-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  Bmb020286
Domain Number - Region: 10-45
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0155
Family V set domains (antibody variable domain-like) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb020286
Sequence length 576
Sequence
PYTVDTLAPSNRSTLYKTELQISDSGHYMCSAPPFSVTKYIVVQNKGAVGCARGALSCGF
RCVLPAYVCDGRTDCADAEDEHPLMCGENVCMQKHGVPSDFVHNRLAGSDVVDYDINTVV
TQVSRTLASCTKFSLKMLAATNSFKAPSVRSAGKGNCYNAVICLRPVFSGTREGVPELVV
MGAVCAGSDRLNCSDGRCVPAAACCGAPAALCRQPACCNEHPSYSRLEGPIEVEYPQVFD
DRHAPDDYGFIQSTIYTVTACALIFMIAVVLLISAICKMHMKRAALRSYAHAERATRRHY
SVHYAQVHVRLAPTLDRIAVPCNPGCPPAAELETRPGFGLASLSAIFSSRYRQVPLPPAE
VEMNAIRASSTSSSIQNYRSPTYCDLQEELFASPESQATGRDLNYMAAPLELFRRRARSS
LDRQRLTLQLGRFQLTLPFRDRRPDTPNVSEVDDEDTYTLNGRTIRLLGADLENYPVVSD
GIARPPPYAEAVRYKLFGPPPEYLSREALNLRVDMEARTNVEMPPRYDDLASGASSDNQP
RAPESNGVAPTLSSVIDELPDIDNDAPGTASSLAPH
Download sequence
Identical sequences Bmb020286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]