SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb021271 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb021271
Domain Number 1 Region: 128-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb021271
Sequence length 329
Sequence
MHPATGNTGRRESLSDWERGFTELQASGAAGRKWSARAPAHAQDTATDQAAPANNNTDAC
KLLVYVSDAKNPAWRLSLCGGNSVAIAARAGTKLLPPKIKIVWNPPSSPYQHTEKLRLVV
AAVYSGAVCSNESQFVCGATNLCVSSYLVCDGVRHCPGGEDEDPSACSHRRDPPLLELLR
RFAARNQELLGLDQPEGITKPSVIMKISESEKSSNAFMEFAAALKPYGPWSYLVVGMLVC
ATILMFCLAWECCCKRSKPSDTPLNMPASCIDLSPTVTVTAASQQLFTQPLPPTPPEYEP
PPSYASLFPRAFKSSPTPVPHCSHQEPPD
Download sequence
Identical sequences Bmb021271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]