SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb021676 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb021676
Domain Number 1 Region: 29-84
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000288
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb021676
Sequence length 86
Sequence
MSDKVLGLSTPQRVGHCVVLYPYTASKIQCNETIQLSHSHPHATVSSPGFPRPYPDDVEC
ITEIRTPPAHTLRLHFEELLTEHEPQ
Download sequence
Identical sequences H9JR02
Bmb021676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]