SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb024819 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb024819
Domain Number 1 Region: 17-71
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000183
Family Spermadhesin, CUB domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb024819
Sequence length 75
Sequence
MYPMSCILNIVVLCVPECDRTFVSRGGASNGTFHAPELLNSNNQSRQCLYTFLAAPGQRV
LVEFRKFELRGKPPE
Download sequence
Identical sequences H9J9Y6
Bmb024819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]