SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb025466 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb025466
Domain Number 1 Region: 658-891
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-41
Family YWTD domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 303-553
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-35
Family YWTD domain 0.0000509
Further Details:      
 
Domain Number 3 Region: 194-295,573-626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-20
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 132-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 988-1031
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 6 Region: 1029-1067
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 7 Region: 955-989
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 8 Region: 96-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 9 Region: 3-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 10 Region: 45-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000615
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  Bmb025466
Domain Number - Region: 898-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb025466
Sequence length 1079
Sequence
PPECDAGQLSCNQYVWNKTYCIPPHYRCDMHVDCVDGSDEADCTYRKCQADDFQCGMEGT
GKVSSQGPCVTKEKKCDGYLDCRTGKDEQDCPGQSIACRLDQFRCASGNKCVDASAKCDH
KDDCGDNSDEAHCSFPPCHIGQFRCSNALCIPANYHCDGYNDCADGSDEANCTAIACPDN
QYLCPKGGPGGVHKCIARSQLCDGKKDCEDKADEEDACSILSCPALGCEYKCVASLAGGA
CSCAAGLMLSADNRTCVDRDECKEWGYCHQLCVNTLGSYKCQCAPGYSLVDGKRCSAGVA
ASPWLVLAHAGAVLRMDLHGRAPQTLANATAAAGLDYHYRRNLLFWSDLKTRKIHSQQLS
APAGLGRFGDAEISVAGSWAPVALAVDWVGDKLYVADSLGQKVDVFELDGRWHAVVLGSN
LTSPADLALDPTLGLMFVADSSAESLHKLVPINNYTEIIRANMDGTHMKAIVSEAAYKAS
GIAVDIIARRVFWCDSLLDYIETVDYDGNHRFLVLRGQQVPSPSRLALFEDRVYWSDSTK
QGISSVNKYGGASSIQAIYKMKDIRDPKAITVIHSLKQTSVNNPCGTNNGGCSQMCIVTA
LQNGGLGYRCACNIGYRLETDLRNCDIVNEFLMYSQQRFIKGKVLNPVIEGFSDAILPVV
SRRARFVGLDFDARDEHIYYSDVLQDVIYRVHRNGTTREIVLASQNEGVEGLAVDWASKN
LYYIDSRKGTLNVLSTRNIAYKRTLLKDLKRPRAIVVHPNKGFIFFSEWDRPANISRSNT
DGTGLLVFENVTLGWPNGLSIDFDTDRLYWCDALLDHVQHSKLDGTDVKTVSSRLIRHPF
SIVIHKEFMYITDWRLDAIVRLHKLTGEQEDIMVREPQTNRLYGVKVYSEKIQKIDPMQP
CARNNGNCQKLCFAIPRNNTEFLTVKCGCPYGEKLAADGQTCESDPNSEPPVQACPQSWD
FTCNNQRCIPKSWVCDGDDDCLDNSDEEQNCTKATCGPREFMCKSGRCISDMFRCDSEND
CGDFSDETGCVNVTCSSAQFQCDNGRCVPSTWKCDSENDCGDGSDEGPHCAEKTCAYFQ
Download sequence
Identical sequences Bmb025466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]