SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb025866 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bmb025866
Domain Number - Region: 4-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00978
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb025866
Sequence length 173
Sequence
MHKDARGEPSCRCTGSFTGRHCRDKSEFAYIASGVAGGVIFIIFLVLLVWMICARSTKRK
EPKKTLTPAIDQNGSQVNFYYGAHTPYAESIAPSHHSTYAHYYDDEEDGWEMPNFYNETY
MKESLHNGMNGKMNSLARSNASIYGTKEDLYDRLKRHAYPGKKEKSDSDSEGQ
Download sequence
Identical sequences Bmb025866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]