SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb027732 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb027732
Domain Number 1 Region: 139-251
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 8.5e-27
Family Frizzled cysteine-rich domain 0.00082
Further Details:      
 
Domain Number 2 Region: 445-620
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.96e-20
Family Eukaryotic proteases 0.012
Further Details:      
 
Domain Number 3 Region: 288-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  Bmb027732
Domain Number - Region: 252-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00746
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb027732
Sequence length 625
Sequence
MKLGRAPDSVPVTRTVVDWHTLGISLAESDPPSLPFSPDSTPSPQDTAQAIDIVTSHITS
TLDRSSKQVVAEDFLHRFKLPDDIRELLRAKNASIRAYDRYPTENYMIASLQLKEDETTT
LEPPTTEIISSEPEVERRECVPVTLGLCSHLPYNTTSYPNMVGHSDKDALMRDLVAFREL
LDAECSHLAQDFVCQMLQPRCEGNHVVRPCRSYCRAFHEGCGARLPERLKAHFDCARFPD
FFGIGSCAPQPDCHSDLQRLALSRRACDSIPDCADAADERECAYCKSAGAGALRCALNER
CLPPALRCDGNPDCPDGSDEAGCLWISRSLSSWQRENSETTLGAVRNRAGYALWAERGRY
GKICATPFENDKKALKSVASSLCKALTFTSSISAEAVLDAEELNKTNFENSTEFRSIAEY
VEIVDPFAAEISFVKSECPQRKGQPKAEWTARFGTVRIQSTTPWQQERRIVGMVRSPVEG
SMLVLVRLEEPVEMTDFVRPICLSNKALYSEERSVCNTLGWTRNRDQLQRVHIVPSPMST
CENVSIANPNGICSEPLYDQDDCDEEEYAGSSMMCFDDKTKRWSIMGVSAWRIACAKIGL
GRPRIYDPVTSHVDWIRRTVSDSAR
Download sequence
Identical sequences Bmb027732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]