SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb028757 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb028757
Domain Number 1 Region: 269-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 189-295
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000377
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 3 Region: 510-639
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000628
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 1018-1170
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000651
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 137-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 755-885
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 7 Region: 708-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000915
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 463-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000185
Family EGF-type module 0.015
Further Details:      
 
Domain Number 9 Region: 384-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000368
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1244-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000662
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 978-1024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000231
Family EGF-type module 0.027
Further Details:      
 
Domain Number 12 Region: 1169-1284
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000706
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  Bmb028757
Domain Number - Region: 73-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00118
Family LDL receptor-like module 0.0064
Further Details:      
 
Domain Number - Region: 893-1021
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00392
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number - Region: 1350-1382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family Laminin-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb028757
Sequence length 1451
Sequence
MKRAAVVVGSSREETMYIDSLPLVVWTLLVTTTHVATQSQYGIGLGIKREVFFLNLEDGY
FGCQVNESTQILQLYELSKLCDGVTDCYKGSDELKSELKCSDDCTKEDGAQCVNGACLNG
VCHCNDGFGGCNCQDPDINECKDRPCDVFAHCTNTVGSFQCSCFPGYEGDGFTCRDINEC
EDPAIASRCVENAECCNLPAHFICKCNRGFEGDGEEECRDIDECRRPGACGTHAICRNYP
GNYTCSCQAGYTGNPFDGCVDVDECINESTCGEVAICRNIDGGYECSCPPGYEGDPRVAC
HDHDECARAACGRGALCENLPGAYRCVCPPGFDGNPDVLCSDVDECKSSETVCGAHAVCT
NTAGSYVCTCAPEYTGDAYAQDGCLDLDECQTLEKPCGTNAICENSAPGYNCVCPQGFAA
QPDPQIACEQVDVNILCKSNFDCTNNAECIDHQCFCKEGFNAKGSICEDVDECSNNKSVC
GENALCINIPGGYNCQCAAGFVGSPPKIGCRAPCEDVKCGKHAYCKPDGMEAYCVCEDGW
TFNPHDIAAGCIDLDECDISLGPVGRCGKNAICSNTPGSFSCNCPEGYTGDAYKQCSDID
ECQLEGACGLGADCLNRDGSYSCECPDGTIPDPDPHIRCAEILACKGDKDCPGNAVCDSN
ARCLCPEPISEMIADVDVNILCKSNFDCTNNAECIDHQCFCKEGFNAKGSICEDVDECSN
NKSVCGENALCINIPGGYNCQCAAGFVGSPPKIGCRAPCEDVKCGKHAYCKPDGMEAYCV
CEDGWTFNPHDIAAGCIDLDECDISLGPVGRCGKNAICSNTPGSFSCNCPEGYTGDAYKQ
CSDIDECQLEGACGLGADCLNRDGSYSCECPDGTIPDPDPHIRCAEILACKGDKDCPGNA
VCDSNARCLCPEPNIGNDCRHPCESLQCGTNSECLLSDQEAQCTCKSGFTGRFQCECPAT
FTGNPYVEGCNPGKILSECSNLNPCPEGEQCILHDGGNVCICPQGFTRNSETGLCEDINE
CVQHGRSPCGLNAICKNLPGSYECKCPQDYSGNPYKICELCDDISCQCQPPYKMIDGSCV
LSGCGKDNKCGTGAECIVISDEVSYCACPAGYTQTSDSTCEDINECTSGTPVCGFGAECI
NTVGSFECKCPPGYSKDKIEGHCSLNQKRCISDSDCFPNEKCVQPGKCMCPPPFYLDVTD
GQKCKSPCERFTCGINAKCTPSDPPRCMCMAGYEGDPYTGCTKRNECHSSPCAYGAICHD
QKGGYKCDCPPNMIGDPYRSGCVFEEEPTQKHLCSSDDQCPNTLACLNHTCISPCATISC
GPNAFCEVENHAAWCRCDPGYTKPEGGKCISACDTYNCAPGAQCIISKTGPTCVCVEGFV
GNPFPGGSCSRDQCGPGIPCEDPLTCVAGRCRQRCEGVLCGVGATCDSQTGRCVCNPFFI
GNPDLLCMPRK
Download sequence
Identical sequences Bmb028757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]