SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb029905 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb029905
Domain Number 1 Region: 423-616
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-51
Family Eukaryotic proteases 0.00088
Further Details:      
 
Domain Number 2 Region: 624-665
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 311-348
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  Bmb029905
Domain Number - Region: 348-383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000314
Family LDL receptor-like module 0.0044
Further Details:      
 
Domain Number - Region: 672-693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0131
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb029905
Sequence length 693
Sequence
MIETMKTERSFEKLGLPPMELAESTTNLGTRSTEIFVVTGTYEYPNITLYDGDMEIFLRL
KNNTLEANKRMKRHVSELSDSIIEPVEEFVLTDEDLQNAREIIVKHDLLCKHGDNDETCI
KITNRLKEMVLKPKLNKDQSNEIPVIPKIKINSLHSLEADRDLNSNNHAIRNSEAVKKRE
IHSVAKTQNILESVPRTQLAFAAQPSENHITDPCLERLLKQYTQARNNYELPHSEYAPPQ
YENPTLNNLHPRYYDPVSHPAFLQGREVEARKSKLHPQDVDIFMSLLTPKNTCVRPEAIS
TKKIDAEARTTLCSDGSKPCDNGEGCITEKQWCDGNVDCSDVSDEAKCDCKSRVDKSRLC
DGYFDCPFGEDEMGCFGKLFAVSNTEGFLHRNLKGDWYAVCHNPYMWAHDTCRRETGLII
RFWDHYYEVQAGMLRRFSFSPQEQNHQVTHVIVNQHYKQDDMKNDLSLLRVEPIIQFSRW
VRPICLPGPDTAGPDWLWGPSPGTICTAVGWGATVEHGPDPDHLREVEVPIWDKCKHEED
RAGKEICAGPSEGGKDACQGDSGGPLLCRNPTNSHQWYLAGIVSHGDGCARKGEPGVYTR
VSLFVKWIKHHIASNSLPIVKPLQECPGFKCKSGISKIHQVISYNLRCDNKADCEDGTDE
LGCTCIDYLSTINEKFLCDVSFHCADGQDELDC
Download sequence
Identical sequences Bmb029905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]