SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030040 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030040
Domain Number 1 Region: 30-79
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000017
Family Spermadhesin, CUB domain 0.0049
Further Details:      
 
Domain Number 2 Region: 148-196
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000249
Family Spermadhesin, CUB domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb030040
Sequence length 237
Sequence
MRRLLVTLIAIAADIYAQDSPREHQGPQICGGRLRGPTGVIQTPNFPNPFPVPIKCRWII
EHDIANGTISIYFTQQYTTSGLTFTEYMYYDESYKLGERRALTVTEDSITRVKWLQLTMR
RLLVTLIAIAADIYAQDSPREHQGPQICGGRLRGPTGVIQTPNFPNPFPVPIKCRWIIEH
DIANGTISIYFTQQYTTSGLTFTEYMYYDESYKLGERRALTVTEDSITRVKWLQVSL
Download sequence
Identical sequences Bmb030040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]