SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030421 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030421
Domain Number 1 Region: 195-445
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-42
Family YWTD domain 0.0000266
Further Details:      
 
Domain Number 2 Region: 5-141
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-25
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 3 Region: 499-692
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-23
Family YWTD domain 0.00065
Further Details:      
 
Domain Number 4 Region: 151-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000311
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 450-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000395
Family EGF-type module 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb030421
Sequence length 693
Sequence
IIHTELYDPRAIALHLTAGWMFWSDWNEKKPKIERANLDGSGRVLLISEKLTWPNSIALD
TVNNKLYWGDARTHKIEVCNMDGTERKELHSNDIIHIFGLTLLDDYLYWTDMQKRTLDRI
NKNTGLDRQPVVEQMANMMGVKAFRLGAPLGWNPCADDNGGCSHLCFNRPDDYICGCPLG
LELTADKKTCVEPEAFLVYSRKNIIGRLSIKNEYNDAVIPIKDLKEVSALALYVSGSKLY
WSDSKTKTINRCSVNGSAVEKIVEWLGLVEGLAIDWSGQNIYWTDTTTQRIEVSRLDGSS
RRAIIWQGLKKPKSIVLDPKKGYMYWSELGSKSIKRAAMDGSSVSVFMEQVGRVHALAID
YERRAIYWAALDPPVVEFAFLNGTGRQTLADNIPMPYALALFNDSVYWGDWNTGQIQQAR
KTDGSNRKSIRKDLDYISDLKLYHRAKSMGSNQCGVDNGGCSHLCLPTPGDVRTDYRCAC
PAHYRLNKDNITCSEPEEFLLFAQKNAVGRIMVANGECNDAYIPLTGLKNVRAIEYDPVE
KQLYWMDDDSHSIRRVPISYSSTSAVADSAAVVTGLSRPYHMVLDVLGRTMYWTCADRDS
INATSIDNNSSTGVIVRGDRMLPRHLAFHQTKRYLIWNDVGRGAIMRANVDGTGRVELAR
ADNATALALDQSAGTVYWAVSRQLHAVDLDSSN
Download sequence
Identical sequences Bmb030421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]