SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030581 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030581
Domain Number 1 Region: 157-338
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-28
Family YWTD domain 0.00028
Further Details:      
 
Domain Number 2 Region: 594-634
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 542-586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 4 Region: 377-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 455-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  Bmb030581
Domain Number - Region: 331-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000574
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 415-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000759
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number - Region: 46-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb030581
Sequence length 663
Sequence
MVGRGAVLSAPVGNMSRSRVLKDDLGDSLRDIFVWSRESQRASTSPCRATPCAALCLASS
GRARCVCPHGELAPDRLSCTPYKSFVMFARVSQIDSLHLDGRTLNAPYPPIRHKCVPSPA
LNAPALNAPALMAPPCMPRPAGQPYSCRALRCCRELMRNAIGLAYQYSTSTLFYSDIQRG
AIHAVHFNGSNHRVLFTKVGAVEGMVFSPATRSLYWTRTSGALVAARLPDGPPVTVLRLS
HGDRPRGIDFDPCQIRIYWTNWNSSHPSIERVYASGRGRQAIVTTAVLMPNALALDHADR
RLYWADARLDKIERMYYDGSHRQVLRSVFSSDDPCAVLNGGCAEICSRDASGGGARCGCG
GGRTLAEDGRACSPSSQPACPPGQFACRKGGCIPDELVCDDVPHCSHGSDASDEDLFYCN
RLRVGVVARCNGAVECADASDERGCGAHTCGALGPDALSCRNGSGCYLRLWTCDGYADCA
DGTDERDCGHYHSGQYGRGSAGLQHVGALRSCAETPVYSSHASMFPEAPTTEVIVDTFEE
LTPQHCDEGQFRCGGDSAAPADVAECIPAEWRCDGRVDCTDGSDEALHCGHRAHNTTCGS
HTFHCAGGACVPLGARCDGAADCEHADDEADCPCALDTFACAGSGLLSARCTTPHSLCAT
ALI
Download sequence
Identical sequences Bmb030581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]