SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030582 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030582
Domain Number 1 Region: 6-74,193-292
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 4.9e-19
Family SGL-like 0.048
Further Details:      
 
Domain Number 2 Region: 399-500
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000915
Family YWTD domain 0.0028
Further Details:      
 
Domain Number 3 Region: 326-377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000241
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb030582
Sequence length 501
Sequence
ISHVEVVVSSGLTTAEGLAVDWVGLNLYWVQSDLHQIEVSKLDGKYRRTLVSGDMDNPRA
IVVDPTAERSRYIESHVTVRVHVLERLGAVGAAHRAQQPGGAGAGRGGARGAGGVAQRPG
AGRARQEAVLGGRAGRRAELRHLRRSRPRLVLTRNPTSSNPSSWAVDSQCIERLHRSVWK
HSERGSLYMALSSAGEDRIEVVRGDGTARRVLLSDREDPLLSGATGLCIDLSSERLYWVN
TGSSSIQYLDLRTWNYTTLSLEIGARPVAMEVYEGEVIYADGEQNLLRKCHKDKCDGASV
YLSQAEGVVSLRVYDAALQEGIESACKLRKQPCAHLCLPVSETHSVCHCATGYVANGTRC
TAVDEVVMYSLSWDVRGVGVEGGPDLLAPLPGLSLASSIDYVAVLALDATAGWLFLGGAG
WIQRASLDGARHDLLHNGTNVGDIALHLQERLVYWVDTSDTSVWRMRYDGAGRSLVARLS
PHQHHPVAIALHKHSIYWLDT
Download sequence
Identical sequences Bmb030582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]