SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030688 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030688
Domain Number 1 Region: 298-314,374-574
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000162
Family Quinoprotein alcohol dehydrogenase-like 0.017
Further Details:      
 
Weak hits

Sequence:  Bmb030688
Domain Number - Region: 203-240,301-358,405-414
Classification Level Classification E-value
Superfamily Plakin repeat 0.00445
Family Plakin repeat 0.011
Further Details:      
 
Domain Number - Region: 904-1043
Classification Level Classification E-value
Superfamily YWTD domain 0.00759
Family YWTD domain 0.019
Further Details:      
 
Domain Number - Region: 728-799,838-1008
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0405
Family All0351-like 0.061
Further Details:      
 
Domain Number - Region: 687-772
Classification Level Classification E-value
Superfamily YceI-like 0.0575
Family YceI-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb030688
Sequence length 1351
Sequence
QVDPTLGQQISVVEKPKDTFATIPGKEVQLVVITSKYDPKTKKLDNPNGFIETSKGVVAS
DGQVHTNFGVIDPKTGKIEHVDSKTGKRELKQATIDSKTGHLTISTGVVDPRTGKVDPGL
GQQLTIIDKDAPKERYVNLVVVTSKYDLKNKKLDLSNGHVDTLPGKIGADGKVHTEFCEV
DPVTGEVTLIDPITKRRDVKKATVDPKTGNLSLTSGVVDPQTGLVDPSLGQQISVIEKPK
DTFTPIPGREVQLVVITSKYDPKQKKLDHPNGHVDTSRGVVAADGRIHTNYGIIDPKTGK
IEYIDPKTGKHETRQAFAESPIGFKSGTLILASGVVDPKTGKIDSSLAQQLTVVEKETKP
VEREIHLVIITTKYDPRTRKIDPSQGHVDTVSGTVSPDGKIRTAFGVVDPATGEVLVTDP
RTGKQEIKKAQVNPATGYMVITSNVVDPKSGKVDPTLIQQFSVVNKPVVQHTKPASKGEV
RLVIVTSKYDPYTKTVDAGTGVVDASKGYVSAEDGKIHTDFGIIDPRSGQILYKDPLTGK
QELKQAEIDPKSGNLIVTTSVVDPKTGRIEPTYAQQITVVDKLNVIAPATQRTKKPDMNT
AEVEHLTGILDPNGLIETKYGVINSNKGCIVLSDGAGQKQNKDGIILPETGQIFINSGAI
DPKTGKIDPNMGMLLSVAKQDDPVVEITTITGPIDPKTGKVSVDDGTVELTKGKVDAETG
HISTKYGVIDPSNGVIFVTDTSDTKPVEIDENNGQITIRGVTDPKTGKVDPKLGQVIVVG
THIDPVVEVTTFVGKVDNKKGIIDGKHSVIESTTGQLNPVNNKIDTKYGQIDLVKGTVTY
NDPKTGKFESHDLKVDPVTGQFLLKTGQVNPKSGKPDKDVGRLICLRIIRNKVDPVSGKQ
IVSNDPKNVKVDPKTNQIWISGPKDPQTGEILYTAGQVDPMTGYIITIYGRMEPRTGYIV
RTTDIDKSFIKVDPVNGQIYTATGEVDENNELLYSASQVDPGSGEIYTKLGKVDPKTGRI
VIVKIYVITQKDDKGRVKEVDPKECTIDETTGRIITTKTVYLYQIIDPITGETIDVDPDD
PRLKGARTTVTQTMTLSGKIDPVTGRIKTEYGDIDPDTGDIDPSTAVRDPVTGQLILHYS
QIDPSHFEDKSGNYTIEKETQDLPANIDIQTVNTHKFSTFGKDESPQRGDEPKTFTEYTT
SEHIRHQGYVSSNTPLSSKIPVSQRAKKTPTPPVVVKTTTKQLLTKNEEGVTHNVEQEVE
NLGTGEVTFSTHTNKAESLEPLEGKSPYVTARAVTTRTATTHHDLDTKAKTQQLEEKTVA
HTLTSSATRQEQRVLTQQVKTMVTTGDQLFV
Download sequence
Identical sequences Bmb030688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]