SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030914 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030914
Domain Number 1 Region: 121-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 180-255
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000572
Family NodB-like polysaccharide deacetylase 0.016
Further Details:      
 
Domain Number 3 Region: 62-103
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000497
Family Tachycitin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb030914
Sequence length 256
Sequence
MARYARVATLAACLLFACALADGHRWRRQADETAKKDESLEQELCKDKDAGEWFRLVAGE
GDNCRDVIQCTASGIQAIRCPAGLFFDIEKQTCDWKDAVKNCKLKNKERKIKPLLYTEEP
LCQDGFLACGDSTCIERGLFCNGEKDCGDGSDENSCELRHAIPRSVSFLTASAPRTGTVI
PGDLPARDVPQMITITFDDAINNNNIELYKEIFNGKRKNPNGCDIKATYFVSHKYTNYSA
VQETHRKGHEIAVHSI
Download sequence
Identical sequences Bmb030914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]