SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030985 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030985
Domain Number 1 Region: 10-45
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 97-131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 43-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  Bmb030985
Domain Number - Region: 130-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb030985
Sequence length 165
Sequence
MFSFCAFLVRKSEWRCRDGTCISFDGKCDGVVDCPDSSDETHALCGKTTCQSNWFRCTYG
ACVDGTAPCNGIQECADNSDELLPQCRGNEVADATNLRDKFKCADGNVIPATAFCDGVAD
CPDGSDETVQACAGRTCPAYLFQCAYGACVDAGSDCNGVSVSLTL
Download sequence
Identical sequences Bmb030985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]