SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb030986 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb030986
Domain Number 1 Region: 53-87
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb030986
Sequence length 105
Sequence
MLRIPWMAHRTNASIVEELGVSTRLSTAFSVTLRRQKDDNFERLITGKVEGKSYNEFECG
DGGCVSIDRVCNGIEDCSGAEDETVCYEMPPENGGPGHGPRVPLW
Download sequence
Identical sequences Bmb030986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]