SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb031119 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb031119
Domain Number 1 Region: 42-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000602
Family LDL receptor-like module 0.0039
Further Details:      
 
Weak hits

Sequence:  Bmb031119
Domain Number - Region: 80-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000759
Family LDL receptor-like module 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb031119
Sequence length 185
Sequence
MVCKTWIDRFSSYFVIFCSVIIFAQSDVPRPRGVSLSKASLYLPTKDFTCFDGTATIPFS
YVNDDYCDCFDGSDEPGTSACINGVFHCTNAGHRPQNLPSSRVNDGVCDCCDGTDEYANP
TACTNICEELGKEARAEAQRVAELHKAGSQLRIDLIEKGNKKRNEMAEQLTQLEKDNAGS
RKNKG
Download sequence
Identical sequences Bmb031119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]