SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb032703 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb032703
Domain Number 1 Region: 15-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000017
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 142-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb032703
Sequence length 255
Sequence
MNAAVPDNMDELCSDGGSLTTPTGIITDGLGNYSVSTQCTWLLSPPRVGPTPPPIRIRLE
SFATECGWDHLYVYDGDSVRAEKLLAVFSGVLEKQDSSWTRQVVARSGFALLHFFSDDAY
VMEGFNVTYAAYSCPSNDHLTNCSNHGECDDGTCKCEPFWTGIACDQPLCPDECNSALGW
GRCKATGCECAPTRAGEDCGRERASAGWRWAWRERGEDVNSVHAPPPASAGHVLLAYGED
LIRVGGETFSQVEFL
Download sequence
Identical sequences Bmb032703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]