SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb032856 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb032856
Domain Number 1 Region: 378-410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000838
Family LDL receptor-like module 0.0035
Further Details:      
 
Weak hits

Sequence:  Bmb032856
Domain Number - Region: 58-95,237-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.019
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb032856
Sequence length 559
Sequence
LRQGSALYPVSFLLRYEFVDVSEQGQPLTDSKSACDRVFKSALTYSGRFQAPRAIFYYGR
GGAQNLTCILRFEAKQGERVQLTFLNTFFGNKHCGTHKDSRTSRWKCDRPPRRTIGGEGF
AQIIITEFPWVGVPIQRDCICTNRSEPINIHTLTAPVVEVNFTVTMMNITEDYDDFAFEG
EYKFIPTGPGDDTVCSTGWGERRVRGSSGEIRLYDKRQMTIVPEIVGDRNVISESVRAEV
ACVHRPWLIEPGGDDISPVQGRYLYVKVPGYEITSSSPFCSTPNRLFIYEARDTTRSKEI
CPDINNNLELFSPDWKSSETPLETSLKPHARSYVIDFLQHEQADYSIKWIELMKKPNFDH
DPDTNVLPEAVSFDCLHSCPELNACIPIALWCDGSAHCPSGYDEDDSNCSFRLSLPPPYI
VAAGGVALLICAVLIAFCACKKRKRKDKEFKARLDGAIPTEERPFDRAKANGVPEASRQY
ATVQKYATIDKYSLSQKYSAGLNDARYYDEVAQRDKLADTRYASLGRGSRNMRYENSRGN
GSRRAMPDLGYPDLKDGFC
Download sequence
Identical sequences Bmb032856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]