SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb034617 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bmb034617
Domain Number - Region: 426-456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000111
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb034617
Sequence length 489
Sequence
FTQYSLVEARRVESNEREEESSTSAVALRAACAVELRVWDGGGEGEPGARSLGHYCDAPP
SLCARASLANATRAPRPCAPPDGYVSAASLLALALTSRPGTATHPLTFSLHYEFVDARLE
GLPLPDDGRRARPAPEECARRLTAPGSFSSPRNALWFGRGGARRLRCVYRFDGEGSRVVL
DLQAATFGREPRCATRPDPVTGRPNCVPDQIESHDGETEAEDGGPTDFDGDHDVPVGCIC
DNSSAPLRFDASGGALELELVARSLRAAEDHRHVHFQGSWSREQPRLCAARRRLAPPGTH
FRLAFPYSNRISECGETPFLMEARGNRSVFLRVWGEEMTPSAPGTEPPPCATSNRVFVYD
AHTSKLVRVICPGGSGAAVQVFTEEWWGRGGRSAALLVVWAAREAGSARLAWMEVWRAGQ
NASSCAHACGPLGACMPGALWCDGAEDCPGGADERGACGAGARLLAALGASGATGAAGAA
VGALICWQS
Download sequence
Identical sequences Bmb034617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]