SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb035535 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb035535
Domain Number 1 Region: 64-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000228
Family Growth factor receptor domain 0.0065
Further Details:      
 
Weak hits

Sequence:  Bmb035535
Domain Number - Region: 13-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0246
Family EGF-like domain of nidogen-1 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb035535
Sequence length 189
Sequence
MESSAIGYPAEQTRGFQGVSCEETQYGPKCGSCPTGYVGDGRQCQHVCDAQKPCGRERRC
MPKSTSPYYECEGCPSGYQWNGYTCVDMDECDLIRPCDDLVSCRNEEGGFTCGPCPPGFT
GSQGWRGTGNERRREHCVDVDECADGRANCPRGRLCVNTPVSFDQELQDSDQRLTGKPGP
RKLFACILQ
Download sequence
Identical sequences Bmb035535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]