SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb035832 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb035832
Domain Number 1 Region: 132-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000612
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 40-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb035832
Sequence length 244
Sequence
MIFNRDFFWSYPDYRPITTRPFRPRNPCDVGFYLDQKTGTCEDINECTNGQADCAAVEIC
VNTQGGYKCECPPNWSLDDVRHRCVPIRRHGLFPPGYGNEPPHDSRPVVSYTSKPPESPV
SPKVTHVDDRGRVFKCPWGYRLGIDNVCEDINECVTGEARCGPLQICTNLPGGYTCSCPN
GHRLAGDHECEDVDECDLAGKMVCVDVDECTESNSRSLCQHRCNNVWGGYRCSCYKGYRL
NIDN
Download sequence
Identical sequences Bmb035832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]