SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb036301 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb036301
Domain Number 1 Region: 96-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.026
Further Details:      
 
Weak hits

Sequence:  Bmb036301
Domain Number - Region: 42-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family Laminin-type module 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb036301
Sequence length 149
Sequence
MHVAVGEGVSARRVRISFRGAHPTPSRQQYYTVRSLTLAARCLCHGHAQRCAVDNKGAKC
ECLHATCGSHCHRCCSGGSWAPHKICDETLECLCGERGQCSFDDTGATLCLNCTENRGGP
SCDKCLFGYYNTVSDGPCVPCDCDPEGSD
Download sequence
Identical sequences Bmb036301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]