SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb037461 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb037461
Domain Number 1 Region: 643-904
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-46
Family YWTD domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 328-590
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-38
Family YWTD domain 0.0000266
Further Details:      
 
Domain Number 3 Region: 25-272
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-30
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 4 Region: 987-1030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000589
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 5 Region: 951-990
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 6 Region: 1028-1069
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  Bmb037461
Domain Number - Region: 907-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 281-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00124
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 600-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb037461
Sequence length 1096
Sequence
MVLKGTQVIDLSTDGSGRAGQLSPVVGIQGGIQLDYDRQGHTLYWLQSISGDSEDDENCT
IYTMPYGGGNKAEFLGRDTGIVGAPSSIAFDWIGRNLYIANRVASNIELIKVDGKVKYRT
IVMANDGGKMSVAKPRALALDPTEGKMYWSDEGGYGVPPKIGKANMDGTNSIILVDTIER
PEAITIDIERKIVYFSTQYPATVISVNTDGNDRKTILDESNGISYPKVIAVLDLRLYILD
PRHEKIIQADLPNGDNIKTIIDNESDLKSFTIFQKRKMIHHPCSQSNGGCEQICIPGDDS
VSRVCACSIGYRKENEIHCVPYKTFAVVSQLDLIRGYSLDTSAEAMVPITGSGHHILHVD
VHFAENYIYWVEFNRGQWNGVFRIRPNGTELQHIIKDGIGSNGIRGLAVDWVAGNLYFTN
VFPHESYVEMCWLDGSNRKVLVKTTMDAPRELAVNPIYRFLYWIDYGQYPRIGRAYLDGS
QWNTLVSSGISNPRDLTIDMLTHDVYWVDSKLDQIQKISYSGGNRQVIRSNLPNPMGIAV
HTGSVYWVDRNLQTIYKSSKLPGNMSMPEKVRTNLGKLRDIVIFDVNNQPTDESNPCRKF
GNGGCEQLCFSFPPDNGVTMRCDCATGQVSATNPTKCDVVDEYLVFTTRTEIRAVNLDPK
STGVPFKPVVNLTNVVGVEFDYADNKLFFTQIRPWARIGWMSANNPSSAAIQNIINKGIN
PEGISYDWTQRKVYWTDSSNNSIYAMNLDGSELVMIARVERPRAIVVDPCNGTLYYTDWG
RFGTSGKIYRTTMAGSLKKAIIDKDLSQPSGLTIDFDENILYWTDAVREKIERSKLDGSD
REVLISATIYPFAITVFGNYIYWTDLQLRGVYRAEKHTGANMIEMVKRLEDSPRDIHVYS
PKRQKCQVNLCKISNGGCAHSCHPAPNNTVECRCDENTKLVNEGRMCVAKNITCDSYKFF
CGNGKCISRMWSCDGDDDCGDNSDEDKNYCAYHSCSPNEFRCNNGRCIFKSWKCDHENDC
KDGSDEEGCVFPPCADGEFTCLNSRCIPMSQVCNGINDCKVSCRASDETQERCPTTQHVP
LHGKGWDKETCSAYQA
Download sequence
Identical sequences Bmb037461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]