SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb037462 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb037462
Domain Number 1 Region: 82-339
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-51
Family YWTD domain 0.00000487
Further Details:      
 
Domain Number 2 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000182
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  Bmb037462
Domain Number - Region: 42-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00481
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb037462
Sequence length 365
Sequence
CPSDQWECPQASGRCINFTQVCDDKLDCPGGTDEGPVCSEKQCSWRGAQCSHGCHETPGG
AQCVCPRGPCRSERTADNHSGAFLIISNRHSILVADLDEQGLERVPIDVENVVATASDMH
TGTIFWSDMKLKKISRLDRGGEPKVIVSTGLDLVEGLAYDWVGGNVYWLDSKLNTIEVAK
EDGAARTTLLSGNITQPRGMCLDPAPDARWLFWTDWGEHPRVERIGMDGTRRMAIITTKI
YWPNGLTLDTATKRVYFADSKLDFIDFCNYDGTGRQQVLSGSHYLLHPHSLTLFEDTLYW
TDRQLNRVLSAHKFKGSNQTVVSHLISQPLSIHVHNPSVQEQYTYACKRDTCQHLCLLST
KQTSG
Download sequence
Identical sequences Bmb037462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]