SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb037602 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb037602
Domain Number 1 Region: 26-87
Classification Level Classification E-value
Superfamily YWTD domain 0.000000034
Family YWTD domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb037602
Sequence length 151
Sequence
MGGTERSVFFVSPDVNFQILCPSTCPRDRVCFADAVFQVIKCIDLHSRQFETIAENCRYP
FGLAINGDKLYWSDWRTLKIEIIDTITQARGQIDIPRSTIRLYGVANAPSECPGAANVCS
QRNGNCNAGQLCLPNGSGGRSCLNGDANYLP
Download sequence
Identical sequences Bmb037602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]