SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb037809 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb037809
Domain Number 1 Region: 26-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 63-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000746
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb037809
Sequence length 106
Sequence
MRRGECGIGDHIRATDIDNLQNEMKHYSRCSSGQMKCRNGKCLSKELFRDGHDDCGDGTD
EPGHTTCSDYLARVMPSRLCDGILHCHDRSDEDPSFCKCFAKKAYR
Download sequence
Identical sequences Bmb037809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]