SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb038051 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb038051
Domain Number 1 Region: 280-504
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-46
Family YWTD domain 0.00000644
Further Details:      
 
Domain Number 2 Region: 63-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000013
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 3 Region: 224-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 105-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 151-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0024
Further Details:      
 
Weak hits

Sequence:  Bmb038051
Domain Number - Region: 194-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 41-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb038051
Sequence length 540
Sequence
MFELDVVKTSLLVPSANASLNIGDVITNPTVLIALTKPTVDFQCDGDNDCGDWTDEDSCP
MVPGSCNAGEFKCNDGKCIPERWRCDNERDCADGGDELNCKPNSIRNCSLDEYTCADRRC
VLKTWLCDGVRDCTNGEDEMNCEVSCEEDQYTCRPQEHLMSNAFRNCVNRKHVCDGMKDC
PRGDDEERCPLKRKCSAEEKCEKLCITTYDGHAACACPMGFLLAEDKYSCRDIDECMYEQ
DPVCSQTCSNTVGSFRCGCMTGYILRPDERSCKPTGESPTLLFSNRIGIRQVWLTGDNYM
SVVKGLHNAVALDYHYEKKLVFWWGLETPAGVAVDWIHDLLFWTDSGTRRVEVATLDGSK
RAVLVANDLDKPRAIAVHPGDALVFWTDWGPNPKIERADMDGDKRKTVIYDEIFWPNGLT
IDYTESKIYWADAKHHVIERAAFDGRDRRKVTTKGLPHPFALTLFDDAIYWTDWHTKSIS
TVNKNTGMGIQTVHAGLNVPMDIHSRSCEETPEKLLLYARRKDLRLKQLESKKPIDSLDM
Download sequence
Identical sequences Bmb038051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]