SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb038429 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb038429
Domain Number 1 Region: 141-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  Bmb038429
Domain Number - Region: 3-60
Classification Level Classification E-value
Superfamily YWTD domain 0.000222
Family YWTD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb038429
Sequence length 431
Sequence
MDNVYLADEGNGIIDYLHPEGTGRENFRELSTSISSMAVTENYIFWTDRRTPKLYWANIH
ETSHKIRRIELRAFSNSSQLLLQTTYPPPSPHDPLTQHPCHRDNPCSQVCVPTHSPTNPY
SYKCLCSPGLVFSNGRCTEVARCSESEIYCHKSNICVEKHKRCNGVVDCSRGEDEEGCTH
VTKKSESQCNPNEILCYELCVAKDSPSPCSPEKHSDITKKPENQCDPNEILCYGLCVAKD
SPSPCSSEKHSDITKKPENQCDPNEILCYGLCVAKDSPSPCSSEKHSDITKKPENQCDPN
EILCYGLCVAKDSPSPCSSEKHSDITKKPESQCNPDEILCYGLCVAKDSPSPCSPEKNSD
ITKKPESQCDPNEILCYGLCVAKDSPSPCSPEKHSDITKKPESQCNPNEILCYGLCVAKD
SPSPCSPEKNS
Download sequence
Identical sequences Bmb038429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]