SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb038809 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb038809
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000123
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb038809
Sequence length 64
Sequence
RDGKHGYSDILAKVCGEAFPEQIKTTGPNAWLKFRSDDTIEYEGFTISIDFVAAPSQNWA
DEGV
Download sequence
Identical sequences Bmb038809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]