SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb038819 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb038819
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.47e-28
Family Eukaryotic proteases 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb038819
Sequence length 189
Sequence
MLARQCGKASGSIVEMRIVGGRRAVPHSFPWTVAILKQKLLHCGGALITNEHVLSAGHCF
KWDEPKIMRVLLGLDHLDNMTGVEIRTISNVKIHEHFTSTALRDEHDIAIVTLNLPARPV
CSDLKYPGCILQIDGNIDRDVSSRINAGWVKWRQVSGTACMKALKLKGKVYKTIISPVRC
MDLNVKRRK
Download sequence
Identical sequences Bmb038819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]