SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb041860 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb041860
Domain Number 1 Region: 67-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family Laminin-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb041860
Sequence length 112
Sequence
YKFCRRRCVSGAVLHAAELRQLHRRGVHMVRLGCQMRRQGIAPGPHPVLWTHLVKFFQWH
FTSCPACQCNGHAVCDARARCVQPCGGRAVGPHCDACAPGHWGNPLNGGLCQ
Download sequence
Identical sequences Bmb041860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]