SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb002356 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb002356
Domain Number 1 Region: 308-549
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-26
Family YWTD domain 0.00081
Further Details:      
 
Domain Number 2 Region: 255-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000176
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 41-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 228-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 185-220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 6 Region: 89-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 7 Region: 130-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  Bmb002356
Domain Number - Region: 535-608
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0643
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb002356
Sequence length 617
Sequence
MFYPECFDVIFIFDQIKNPFYDGVPTKYPQKNVFNIVRESVSCKPGYYQCRDRECIELKK
RCDGHQDCFDYSDEEECDEPVVVEEPKIHRCAEWEYSCERNRSICLPITARCNMKTDCPG
GTDEIGCDYRCTPHGMFGCKQQIRCLAMNRVCDGNKECDDGSDETPDACALVNRTSHLYP
VMLYPAAECRDGFLCGNGQCIEWAEVCDRTPNCFDGSDESIHCFSACDNNTCAHACQATP
LGPRCLCPAGYSAAPDRRTCADVDECRAGLCSQACVNTPGSFLCSCHHGYALRSDRRSCK
AVTGNMSILYVSGNTVRSVSADGYGAIEYSDPDLGDITDLDFNVRTKRLYVTSTESGKLI
ELNVTHDVVAVTNVGRPTRVAVDWVTGNVYFADSTPGASCVRVCDVTRRRCARLQKIPSD
ATVKALIVEPASRRMFYCVQRGHESVVWSASLSGRSALDLLHVTQCSGLAADSFTRRLYV
AETAPPHIMVVDFDGKNPFIENILGKSSSFNLQAPHALALFEDHIYYLVGDSYRLGRCLL
HGPKNCETYIYRVFDANTFVIRHESIQRDDLVNECAAHDCSNVCVLEKAPVCVCDDGHVR
DDGNCDPSNKNEVRFVW
Download sequence
Identical sequences Bmb002356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]