SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb004636 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb004636
Domain Number 1 Region: 269-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000091
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 34-171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000677
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 3 Region: 441-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  Bmb004636
Domain Number - Region: 211-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb004636
Sequence length 522
Sequence
MCRADAGCFIFLTYTLATTPGSFAAAPVGPSDRPEAYFNGSSYIRLSRPISLKQLVGLSF
RTCVGGELFSQRFEGYTLHVTALYEQVVVSWARPAQPHREVGLVKETLDNRWHWVALRYK
PNPPSLLLEVDRDTQVISNVTWNPELLSPGALEAGGAVVLVGNVFSGCIHEGPQLEFHAA
GAQLRNVVFGNCPLTTDECIDRKDVLRIPPKDHCYNEPCMRHGTCISRHDSRRSLMGETR
RVLGSKDATLPVFRSGTYCELEVSLDPLCVAGPCRNNGSCSVPPGGDTYLCTCPPGYTGR
NCETDVDECSGAAACLNGGRCVDAVNNYTCDCTATGYTGARCETNVNECEEDRALCGHGV
CYDTYGGFVCACQPGLHRGALPQGSSTTGTGGAGSPGAVPGAVVAGGAVPGGAVPRPAVC
ICDVGYYGAAGLSPNCSRAESACEAGVCLNGASCEQGPDHFNCSCAPGYRGPYCEMGGRA
APDPQPERCAAGPCLHALSCVDLVVSVPPTVPLLPSAYPLVA
Download sequence
Identical sequences Bmb004636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]