SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb006818 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb006818
Domain Number 1 Region: 38-106
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000013
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 104-148
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000288
Family Hairy Orange domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb006818
Sequence length 250
Sequence
YNSNDGFGRVSGEQLSFAAPSEDEAEYPPGSYLKKGKQDPMSHRIIEKRRRDRMNNCLAD
LSRLIPPEYLKKGRGRVEKTEIIEMAIRHLKYLQERVNAAERTSGEEYRAGYQEAVAEAV
RFLVEVQGYGPGDGLSVSMTSHLQRHCEAITKGEPVHREKSRSHPGGSSSETASSSSSSH
GYAVKVIASAPPPAPPTFTQEPYDERPPGPYSMDCDRGTVNPLPVLPRYKTTNKFYIRSY
VLLKSSWPKG
Download sequence
Identical sequences Bmb006818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]