SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb007204 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb007204
Domain Number 1 Region: 644-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000698
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 2 Region: 221-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 3 Region: 359-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000254
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 4 Region: 747-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.00078
Further Details:      
 
Domain Number 5 Region: 700-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 48-113
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000482
Family APC10-like 0.081
Further Details:      
 
Domain Number 7 Region: 324-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  Bmb007204
Domain Number - Region: 607-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000725
Family EGF-type module 0.087
Further Details:      
 
Domain Number - Region: 281-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family Laminin-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb007204
Sequence length 808
Sequence
MEATNTCGDNGVKLYCIQTSAGTSTRSCDYCQPGQFSSYYLTDLHHEQDNQTWWQSETMK
EGIQYPNQVNLTLHLGKAYDITYVRIVFYSPRPQSFAIYKKTNEDKVWEPFQYFSASCRE
TYGVEEQKSAELGAETRALCTSEYSDISPLSGGNVPFSTLEGRPSAYTFDSSPELQDWVT
ATDLRISLDRLNTFGDEIFGDVQVLQSYWYAIADVAVGARCKCNGHASVCDSQQQPDGTK
TRSCRCEHNTAGRECERCLDFYNDAPWGRASSTNVHECKACNCNGFSNKCYFDQELYERT
GHGGHCLECSDNRDGPNCSRSLQCNAEGKCQCKPGVTGDKCDACAPNHYEFTNQGCKPCG
CNESGSYGNTPQCDPQTGVCLCKQNVEGRRCRECKPGFFNLDLQNEFGCTPCFCFGHSSQ
CSSAPKYQVHDISAHFIRDSEKWDAVDETGKPAQLQFNANTQNIAVVSKNTEIVYFLAPN
QFLGDQRPSYNHDMKFSLKLGEHSGYPSAQDIILEGARTSISMNIYGQNNPEPTDQPQEY
TFRLQEDPRYGWSPTLSNYEFMSILQNLTAIKIRGTYNKGGVGYLINFKLETAKIGREKG
AAPANWVEKCSCPKAYVGDYCEECAPGFKHEPANGGPYSTCIPCDCNGHAHICDTATGFC
ICKHNTTGSNCELCAKGFYGNAIAGTPDDCKPCPCPKDSGCIQLMDQSIVCTDCPDGYAG
PRCEVCADGHFGDPNGQFGPQKQCEECQCNGNVDLNAVGNCNRTTGECLKCIYNTAGQHC
DKCLSAGVPENWESCCTTGPVGDAKDIG
Download sequence
Identical sequences Bmb007204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]