SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb007256 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb007256
Domain Number 1 Region: 271-484
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-38
Family Nuclear receptor ligand-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb007256
Sequence length 745
Sequence
MVVLARVGSEKFLPPETVGPVRYGRVPKRPREASPSDQEQQEQDPPQAPQWELAREPQPE
PQPESQREAQRELQHDLPPTSQHEQLRRRLQEPPQPQELQHHRAQQLAIESVHQALRQAQ
QQRLQQAQQALQQEQQHRMNQALQHAQQQRLQQALQQVQHQMLQQTHHQRLIQAQQVLQR
EQQHRLQQAQRQLSQDQQEAQQLMVQMQQRVPEPVAGPSTEDQESMRAGVHRDLIDQITR
AHIENNSYREGLREELEDRTEVLKIEGLTTGPGPVANNAPTNPTNRVTEMRSVLWHNVAL
RMTPSVQQVVEFAKHIPGFQNLQQDDQLILIKLGFFEVWLSRIARLSNPEWLCFDDGTAI
SQNQLSVIYDAPFASGVLTYLWDLAKLRLTEEELAIFTTSLLLSPTRAGLTDVQAVTDLH
QAVVDAMQSLVNSNAGSGAPARLEALINATHEARNLGFRHNNLLEWCRTNWSRLVVPELF
AEIFDIPKVTVSASNGNAEQQAENADAVPEQAVDQAPEQAAVQAADAVAEAALGLAPEPI
AGPSYEEPIAGPSYEPVAGPSYEPVAGPSYEPLPGPSHGRTAYVIAHTANHQRHAAIDGQ
ARAAIGSQRIAALGGQIMAHAGGQRMAVADNPGILACPRPEMAALGGPGIVNFGGGLPSI
ASIGRPSMIPLGGVGMAALGGPGIVAVGGQAMAAAAAAPGMSANGSPAMGAGAGPIPAMD
PAGDPAMAARPAPDQPLDLGPGPAF
Download sequence
Identical sequences Bmb007256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]