SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb010415 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb010415
Domain Number 1 Region: 183-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb010415
Sequence length 307
Sequence
MKAAWSRIVFMWERNAFPLSRVMPKYFTFGAHGMGWSYIVIGRMTEAKVLTCLVGSGQSD
VQAPPYVPAYLKNQNFAKTGYPGVKTHYGGTKTVYGGTKTGYGGTKTGYGGTGYGGPNTG
YGGPHGGYGGSNMGYGQSSGGHGFSWVTPSQYSETRSWHSHSGEAPNYQQFVDNAMQGLQ
PKCDPECRNTGICVDTNTCLCPANYQGKYCEFEKKPCLSYPPLPMNARRKCSSEHSWGCT
PVRTSDLCISEMFEISELNVTETAMYTDANIRCASRSTKSSTHHDLHAIVVFAHAACAHI
HHPAFAG
Download sequence
Identical sequences Bmb010415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]