SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb011230 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb011230
Domain Number 1 Region: 180-489
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.17e-31
Family NodB-like polysaccharide deacetylase 0.02
Further Details:      
 
Domain Number 2 Region: 135-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 85-120
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000152
Family Tachycitin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb011230
Sequence length 557
Sequence
MARHAFLCLGVLLVGSLVCSTSRVKRQDDDGAGDEPNADQLCDGRPADEYFRLTTEGDCR
DVVRCDQGLENSVTRLASVRCPGGCTRSGLKQITCPSGLAFDLDKQTCDWKGKVNNCDKL
EKPRKVLPILKTDEPICPEGKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRA
PDCDPNQCVLPDCFCSADGTRIPGGIEPNQVPQMVTITFNGAVNVDNIDLYEQIFNGNRH
NPNGCQIKGTFFVSHKYTNYAAVQELHRKGHEISVFSITHKDDPQYWTSGSYDDWLAEMA
GARLIIERYANITDSSIIGVRAPYLRVGGNKQFEMMGDQYFVYDASITAPLGRVPIWPYT
LYFRMPHKCNGNAHNCPSRSHPVWEMVMNELDRRDDPTFDESLPGCHVVDSCSNIQSGEQ
FGRLLRHNFNRHYTTNRAPLGFHFHASWLKSKKEYRDELIKFIEEMLEKNDVYFTSLIQV
IQWMQNPTELSSLRDFQEWKQDKCDVKGQPFCSLPNACPLTTRELPGETLRLFTCMECPN
NYPWILDPQGEGYNVKK
Download sequence
Identical sequences Bmb011230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]