SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb012432 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb012432
Domain Number 1 Region: 322-422
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.03e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0008
Further Details:      
 
Domain Number 2 Region: 140-194,221-280
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000838
Family Flavin-binding PAS domain 0.051
Further Details:      
 
Domain Number 3 Region: 58-141
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000864
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb012432
Sequence length 638
Sequence
MYLNTCLIDVVIIGADPAKDLQKRRAGSVGSDEDDGSGGKYTRMEEDNIQDKERFASREN
HCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTGNTSTDGT
YKPSFLTDQELKHLILEAADGFLFVVSCDTGRIIYVSDSIAPVLNYSQGEWYSSCLYDQV
HPDDVEKVREQLSTQEPQNTGRILDLKTGTVKKEGHQSSMRQVMGSRRGFICRMRVGGTA
EGAHLGRLRARNSLGASHDGHNYAVVHCTGYIKNWPPTGMQMDRPVEDELHSSHCCLVAI
GRLQVTSTPNNSENSLCNGGVEFVSRHSVDGRFTFADQRATQVIGYAPADLLGKLCYEFY
HPEDQQHMRDNFDQVLKLKGQIISLMYRFRTKSREWVWLRTSAFAFLNPYNDDVEYIVCT
NTLANRSLASSGGEATPEEGYDYHLRHRDVYPAAPPAPPAPHAPAAPSALHQHHHAPAAE
VSGVYVSGGGGGGGSGARSPADTGAYPAHYAPNYSPHRPANTPPHTTWTTLRPSGGGGGG
ESYAYSGETTAGAPPDTSPGRSPPAPPYLPPAHYHHNHHPHPTHGMWTWQGGAAGGGAAA
PEGTHAPHELSDMLQILDQSGTATFEDLNINMFNSNFE
Download sequence
Identical sequences H9J1T5
Bmb012432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]