SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb012555 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb012555
Domain Number 1 Region: 90-219,246-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-35
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-30
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 3 Region: 621-667
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000368
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  Bmb012555
Domain Number - Region: 3-60
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000274
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number - Region: 520-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0263
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 558-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0376
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb012555
Sequence length 1497
Sequence
MATLSDGAWHRIEIKWLGTDISVTVDYGLRTVLMPMLANKIQGQYIGKILIGGLDTTAGL
LASDVGFFEVASSGSQCVARREGGILCQGCSIDAAYTTAVCELRARSFPVSSFLTFPGLK
RRHRIHLKLKFATQTTSGLLLYNGRYNERHDFLALELVSSEAGRGGGPGLRFSFSLGGGK
SEITVEGNVGDGSWHTVEIEYFNRTITMILDDCDKVLSLAGAADFGLKYACANFTRKVLP
ARCEIPTETCHRFLDLTGPLQIGGLPNIPSSFQVKNKDFVGCISDFYIDHKFIDLNSYVA
DNGTLAGCPEKRSRCSSAPCYNGAECSDLWDTYICDCKEGHTGKDCADSTGPPWRFGGDG
MLSFNPLLRPIQLPWLNALSIRTRQRDAFVMSIQVGQNSTIVISLKSGLLHYSYNGETMY
LPMATLSDGAWHRIEIKWLGTDISVTVDYGLRTVLMPMLANKIQVQYIGKILIGGLDTTA
GLLASDVGFFEGCIQDVRIGTAQSLLNRPTVRENVRDGCQSRADCMLSICPPYSKCVTSW
DSSTCTCEAGRVGPQCVSACELGPCGAARCVPDQTPKGYSCACEPGYTAYHVRLHRIRER
RMSRRMENHYKPEGTAECLPCQCYAAGSENSSCEAATGQCHCRPGVIGRACDACANAYAE
VTPNSGCEVVYDGCPRSFAGGVWWPRTKFGVETITDCPPGSSGRATRTCDETKDVPWQDP
DMFNCTTATFYQLRKQLHKIETGELTMNTFVGVRVAADLSTACANTPRLYGADVVVAEGI
LLELMDYELRQAGLNLTHSQDKDYVRNLLKSTNTILNVEYEREWKRIRELTGHGAELLVQ
KFDEYIAVLAESQHDTYTSPFEIVTKDVVISVDTVTSESIYGFEPTQLNRLNVDSYTTER
VVALPDTSAFIHSPIQATGYYGNGKTNKNKKPSSPTVSFPKYNNYVRSKNKFDKYTRVLL
PLDLLGISNNNLQDITDTNYETRAVFGYVQYSRNSSQLMPLRMDDSVSLRWGVNITIGSP
ILQIAVFVPESIWTRETGEGSEDNSIEHNAEETEGILYANRGTKHYQANRVSSQRQNRPH
TKEDPPAEHGPVLIQPAFKKHERNDQIQENESLFVADRDDGPKVMALVMDGETRSNATGV
GKKMYRSLSGIRLKKPIRLQIWLDINRETFGSRTNPQCVHWSTLRGSGEWSRVGCHTEID
YDWSPYSEEPLLINCTCNHLSTFAVLVDEVDVEFIPEPSLLECCRVLPYCWCSAWLGRVD
CVALAPLLVELRDFISAPLCAPARRRLRRARNRARALPPRTARTSTGTRSCTCWVSCHEP
VVWWVVIPAGVYAASAFVFLAGATRAAFTVRDHVTGFGNLRMLLAVSIVCLPLLCVAWAS
ALLLGSEAGGRRHALSAVLSGAVLLHAIAASLGYIAFNVRVRDNLKRTVLRCMGKKVPLA
DTSVIISSSAHNLSQVNRSSLAYHSSTEPGRQMRNIGISASSTTSRSTTKTSSSPYR
Download sequence
Identical sequences Bmb012555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]