SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb013465 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb013465
Domain Number 1 Region: 59-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000136
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb013465
Sequence length 180
Sequence
MREAALLRYTPTRRWTIFGIETNPRSQFLGARPEIGALLHVTERPEFNIGRTPVVLTKYV
DECATNNGGCEQRCVNDPGSFHCECSPPLSLASDGKKCVPRIPLAIAEPLPLVRASSRCY
APCDTVTWLTRKVRQLNDQLHATHAALKKLLEHPMLKDDGEPFAVMCAWYIVFALKGGQV
Download sequence
Identical sequences Bmb013465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]