SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb014302 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb014302
Domain Number 1 Region: 73-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  Bmb014302
Domain Number - Region: 42-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00402
Family EGF-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb014302
Sequence length 162
Sequence
MPLCVCAAICAANCHSERGFCRRPGECRCKVGWTGPTCAQCHRYPGCKHGTCRKPWECIC
KKGWGGMLCDEELNYCEDHPDTCKNGGQCQSLEAQDGHYRCQCPSGVTGKHCDVIPANMT
TTEASTVQEFTVEVITDDGSAENTSDKTTTVAEPNIDENETE
Download sequence
Identical sequences Bmb014302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]