SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb016311 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb016311
Domain Number 1 Region: 107-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000445
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 
Domain Number 2 Region: 24-105
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000051
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb016311
Sequence length 241
Sequence
MGDVGRTYELEVRRPREDHLPFVCHLNFTATGGNYGDIIQLTFDTFTVGKFVSFTSDGCP
DGHMTIVERSPSPPTGQWCGSAWGYTVYFSESDSINMTLRLDRLSQQDLLIWDQCNVVQD
YLTVWDGSTRDSPVLVRLCGGDAVPDIISREYVRGSLKVAPVTEKLRSARLGWYAHVMRR
NECGVGKRMLTMNVEGYRGRGRPKKKWMDCVKDDMGKRGVREEMVYDRRVWKEKTCCADP
R
Download sequence
Identical sequences Bmb016311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]