SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb018168 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb018168
Domain Number 1 Region: 287-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000345
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 2 Region: 259-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000789
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 227-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000822
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 145-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000299
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 187-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000518
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  Bmb018168
Domain Number - Region: 35-189
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00455
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb018168
Sequence length 561
Sequence
MTKQSVADVGGPWIEEEQRWGGPSEAHLRVSFRVTCAPHYYGAGCAVLCRPRDDSFGHYT
CSSAGEIVCQDGWTGDYCSKPKCLAGCDSEHGYCTKPDECICHSGWVGKRCDKCEPHPGC
VHGTCSRPWDCICKEGWGGLFCNQDLNYCTNHRPCRNGGTCLNTGQGSYTCVCPPEYTGS
DCEKSLHSCAVRPCLNGGLCVPDEGGELSCTCPQGYEGARCETRRLTCFDRPCHNGGTCE
PKSSGYVCVCPVGFAGTDCALEADPCAANPCRNGATCSRAGNGFKCTCRTGFRGNRCEID
IDDCAGILCEHGGTCVDLVNGQKCQCAPGFLGPRCETRVDMCLTKPCANGGECLVLDNDY
GCRCRPGFTGKDCSIDIDECASSPCRNGGTCRDRVDGYRCVCPHGWGGRSCTVSLSELAA
KQAGGHLPRVGDSDEEERLSAQQVAWIAALGALVPAGAGAAALAVVCVRRRRARAAAAAD
AEARAQNAANRGRRSRDPQHVGQRYVVSEAGAGGRGGVRAGRPLLAADVRHRKCSARRAL
DTIISFITGTDALAIQAVRRV
Download sequence
Identical sequences Bmb018168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]