SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb018415 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb018415
Domain Number 1 Region: 10-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-28
Family Nuclear receptor 0.0002
Further Details:      
 
Domain Number 2 Region: 82-96,134-284
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.54e-28
Family Nuclear receptor ligand-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bmb018415
Sequence length 304
Sequence
MESMTGRILYDVPCAVCRDHSSGKHYGVFACDGCAGFFKRSVRRDRRYTCKARNPGGCVV
DKAHRNQCRACRLAKCLDAGMNKDAVQHERGPRNSTIRRQMALFLKDPALPTPEMGLTVP
PPLDLAVPKHNFMSPPQNSLFQHPYPFNRIHMINPSVVNISLKAPSPPPITAALLSPKDP
EAMCEAAARLLFMNVKWAKNVPAFASLSLPDRLLLLEESWKDLFIIGSAQFLYPLDLKIL
SEGNARIDSRDVEMFETSLAEIVKVHPDSNEYACLRAIVLFKTSFVDVNILCRVYDKDLS
AGPI
Download sequence
Identical sequences Bmb018415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]