SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb019659 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb019659
Domain Number 1 Region: 336-456
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-17
Family YWTD domain 0.00015
Further Details:      
 
Domain Number 2 Region: 167-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 41-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 4 Region: 79-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 2-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 6 Region: 252-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 125-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 288-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 9 Region: 212-244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb019659
Sequence length 458
Sequence
MVCQEYRFECLSDGLCIPRSWRCDATADCPDGSDEHQCDETCRSDEFTCGNGKCIQMRWV
CDGDDDCGDDSDEVKCPTPTCQPQSHFSCTDGQCISAWWHCDGDVDCADGSDEVGCVSTP
KVRSPCISTEFECNDRITCVHRAWVCDGDHDCPDGGDEALELCRGNVTCRLDQFQCKDHS
CIPGALYCNGVKDCPDGSDEYNCTRQKTICDKRTEFDCGGGMCIPLSKVCDKHVDCPNFE
DEPRDRCGENECEKNNGGCSQRCVDTPIGYYCDCEKGYKLIDNRTCEDIDECADPGSCSQ
ICINEKGTFKCECHTGYARDPRDRTRCKATEGHPSLLFARKHDIRKISLDHHEMVAIVND
TKSATALDYVFRTGMIFWSDVNDEKIYKAPIDEGTQRTVVIGEQLITSDGLAVDWVYNHL
YWTDTGHNHIELSDLQGNMRKILIRDRLEEPRAIALIL
Download sequence
Identical sequences Bmb019659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]