SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb020683 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb020683
Domain Number 1 Region: 11-279
Classification Level Classification E-value
Superfamily SIS domain 2.2e-107
Family Phosphoglucose isomerase, PGI 0.00000000534
Further Details:      
 
Domain Number 2 Region: 371-467
Classification Level Classification E-value
Superfamily SIS domain 6.35e-25
Family Phosphoglucose isomerase, PGI 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb020683
Sequence length 503
Sequence
MTQSLCIPTPNDGDILLDYSKNRINSDVFKLLLDLAKSRNVEQARDAMFAGQKINFTEDR
AVLHIALRNRQNKPILVNGKDVSTDVNAVLEHMKEFSDQVVSGQWKGYTGKAITDVINIG
IGGSDVGPLMVTEALKPYANHLKVHFVSNIDGTHLAEVLKKLNPETALFIIASKTFTTQE
TITNASSAKTWFLESAKDPSAVARHFVALSTNAEKVTAFGIDANNMFGFWDWVGGRYSLW
SAIGLSISLYIGHENFEKLLDGANFMDQHFVTAPLEKNVWPPSPVPRPTCEGDPKHLEGQ
GLGEIRLPGPRSTAEGLCVSHTPCRLGCDPVQELTETTMPSEHLREPESEASSVTIHPIH
KDRANRLDGPTTSRRKNAPVILALLGVWYHNFYGAETHALLPYDQYLHRLIPCDFIAPAQ
THNPISNGVHHKILLANFLAQTEALMKGKTADEAKAELEKSGMAPEAMRQDPSAQGIQRK
PAYKLYCSEEDHSIHFRSTYWYV
Download sequence
Identical sequences Bmb020683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]