SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb020838 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb020838
Domain Number 1 Region: 244-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family Laminin-type module 0.088
Further Details:      
 
Weak hits

Sequence:  Bmb020838
Domain Number - Region: 101-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00227
Family Galactose-binding domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bmb020838
Sequence length 319
Sequence
MAALVSALLLAVLLAAAVATPPDPCYEESRPRRCIPDFVNAAFGAPVIASSACGRRGPEN
LCDPPLDQSPELACRVCDAARPDRRHPSLYLTDLNNPNNITCWRSAALMPASYDSPPDNV
SLTLSLGKKYELTYISLQFCPKSARPDSVAIYKSADYGLNWQPFQFYSMQEARDLHLVPL
EGRPSAANFDLSPVLQDWVTATDVRVVFNRLHMVNEGDEIDLKKQAAPGTQHYAVSDFAV
GGRCKCNGHASRCIPMKEGEGSSAGGVVQLACDCKHNTAGRDCERCKPFHFDRPWGRATA
RDANECKGQSNVYHGIGKM
Download sequence
Identical sequences Bmb020838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]